PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00008976-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 408aa    MW: 45710.3 Da    PI: 6.3654
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00008976-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.52.2e-083273641954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  SMil_00008976-RA_Salv 327 FHNflHPYPKDAEKHLLALKSGLTRSQVSNWFINARVR 364
                            776679******************************88 PP

2BELL70.23.7e-23200269272
                   BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            ++e+++kk +L+sll+ Vd++Y+q+ ++++tv+s+F+ v+++++ ++++++Al ++S  +r L+++i+ +i
  SMil_00008976-RA_Salv 200 EMEIESKKRHLMSLLQVVDDQYNQCLDEIHTVVSAFHSVTEVDP-ALHARFALPTVSVMYRDLRERISRHI 269
                            5799****************************************.79*********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575128No hitNo description
SMARTSM005744.3E-19138267IPR006563POX domain
PfamPF075264.6E-24149266IPR006563POX domain
SMARTSM003892.4E-5308372IPR001356Homeobox domain
CDDcd000861.34E-11308369No hitNo description
SuperFamilySSF466893.25E-15310377IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-25311374IPR009057Homeodomain-like
PfamPF059202.6E-14325364IPR008422Homeobox KN domain
PROSITE profilePS5007110.77327368IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MQRDAATGPY YPVADAGSLH SALISLGCSD LSHVMAGFPL PPAFGEETVA SSRVGDEFWS  60
TPSAPYTFEP SKIGVDSMFE APVEALPFDP TAGWVVPCPE LQESSITTRG AAPEPELSSS  120
GVSSHTSGSS LSLNFASCGA AFPAATPPFF EAMQEILAEF ASYALVNCDH TSPGSSDRSF  180
VFHNNNNNNN SNDSFSYGKE MEIESKKRHL MSLLQVVDDQ YNQCLDEIHT VVSAFHSVTE  240
VDPALHARFA LPTVSVMYRD LRERISRHIL AAGVGQAREE ERERSFETSL VHKQWALEQL  300
KKKDHHLWRP QRGLPERSVS VLRAWMFHNF LHPYPKDAEK HLLALKSGLT RSQVSNWFIN  360
ARVRLWKPMI EEMYAEMNRR KAPRNQEEAI NGSHRNLLRF ESRRFTVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_B3e-14314372563Homeobox protein Meis2
4xrm_A3e-14314372563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096864.11e-117PREDICTED: homeobox protein ATH1 isoform X1
SwissprotP487311e-94ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A022Q1E41e-112A0A022Q1E4_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000769951e-105(Solanum tuberosum)
STRINGVIT_04s0008g00880.t011e-104(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.12e-89homeobox gene 1